TPT
Total:
$0.00
Selected
Subjects
Prices

Subjects

Arts & Music
English Language Arts
Foreign Language
Holidays/Seasonal
Math
Science
Social Studies - History
Specialty
For All Subject Areas
3,768 results

Elementary phonics flash cards $5-10

Preview of Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

You understand the importance of sight words and decoding practice! These high frequency word flashcards help children read sight words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports learning new sight words within a sentence. What is included?400 sight word card
Preview of ABC Big Flashcards w/ Movements

ABC Big Flashcards w/ Movements

Created by
Lisaelaine
ABC Big Flashcards with optional backside with letter, movement explanation, and keyword. A-Z, short and long vowel sounds, both sounds for c,g,s,x and all 4 sounds of y included. **Letters on top!A-apple,apronB-board, ball (2 options)C-cat, circle (both sounds of c)D-dogE-edge, eagleF-front teeth, fish (2 options)G-guitar, giraffe (both sounds of g)H- heartI- igloo, iceJ- jacketK- keyL- lionM- monkey, meal (2 options)N-noseO-octopus, openP- pig, push (2 options)Q-queenR- rainbowS- snake, dogs (
Preview of PHONEME BLENDING & SEGMENTING CVC WORD FLASH CARD WITH PICTURE ACTIVITY GRAPHEME

PHONEME BLENDING & SEGMENTING CVC WORD FLASH CARD WITH PICTURE ACTIVITY GRAPHEME

Created by
FREE YOUR HEART
Blending and segmenting are vital skills in learning to read and write. This phoneme blending and segmentation resource will enhance students' phonemic awareness, phoneme-grapheme correspondence, together with decoding and encoding skills. This Science of Reading aligned phonics bundle promotes orthographic mapping as students connect phonemes (sounds) to graphemes (printed symbols: letter / letter combinations). This process (which happens in the brain) will strengthen students' reading skil
Preview of Two Letter Consonant Blends BIG Flashcards

Two Letter Consonant Blends BIG Flashcards

Created by
Lisaelaine
Two Letter Consonant Blends BIG Flashcards-22 Blends Flashcards Front: letters and keyword pictureBack: letters, sound, movement explanation, and keywordBlends included:blclflglplslbrcrdrfrgrprtrscskslsmsnspstswtw
Preview of Phonics Intervention Rules Posters Blends Digraphs Vowel Teams Letter Sounds

Phonics Intervention Rules Posters Blends Digraphs Vowel Teams Letter Sounds

Do you teach vowel teams? digraphs? consonant blends? Build phonics and letter recognition and understanding with these best-selling Phonics Cards! These Phonics Cards include large-sized posters as well as small individual student reference cards and are an excellent resource for young students to use when reading, writing, and spelling. The larger cards are great for displaying in the classroom and using during full class and small group instruction, and the smaller student reference cards are
Preview of Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

You understand the importance of sight word practice! These sight word flashcards help children read high frequency words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports new learning sight words within a sentence. What is included?250 sight word cards with decodab
Preview of Heart Word Flash Cards | Dolch Sight Words| High Frequency Words

Heart Word Flash Cards | Dolch Sight Words| High Frequency Words

Help your students learn how to read those tricky high frequency words using heart words! This resource includes 220 flash cards with visuals and are perfect for your Kindergarten, 1st, and 2nd grade students!Check out the preview to get a closer look at this product!What are Heart Words?Heart words are high-frequency words where some part of the word is irregularly spelled. This irregular part must be taught explicitly and memorized by “heart”. This product includes:A downloadable PDF file220 F
Preview of Phonics Flashcards - Letters, Blends, Digraphs, Diphthongs, Vowel Teams & More

Phonics Flashcards - Letters, Blends, Digraphs, Diphthongs, Vowel Teams & More

In need of some phonics flashcards for your review, instruction, or sound wall? Use these phonics flashcards to review phonetic concepts, hang them up for reference, or use them as headings for a sound wall. Each card includes letters, a corresponding picture, and the word of the image with the letter(s) in red. Check out the preview to learn more! Includes over 170 cards.Phonics Flashcards Included...Alphabet cards (uppercase/lowercase together on the same card)DigraphsSounds of YMagic e with v
Preview of Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Research shows that consistent review of previously taught skills and concepts is one of the BEST ways to ensure kids master foundational literacy skills. This resource includes EVERYTHING you need to implement an engaging, quick and effective review routine. These letter cards, high-frequency word cards, assessments and progress monitoring sheets are a perfect addition to your whole group, small group, or online learning instruction. This Resource Includes: Over 190 Printable Phoneme-Grapheme C
Preview of Kindergarten Flash Cards BUNDLE - Alphabet Letters, Numbers, 2D and 3D Shapes

Kindergarten Flash Cards BUNDLE - Alphabet Letters, Numbers, 2D and 3D Shapes

Our best-selling flash cards are now available at a discount as a BUNDLE. This set includes:Alphabet Letter Flash Cards - Uppercase and Lowercase Letters perfect for letter identifcation practice, word building, letter matching, and more!Number Flash Cards - Students work with numbers 1 to 20 practicing number identification and number sense activities.2D Shapes Flash Cards - These are perfect to send home for students to practice their shapes.3D Shapes Flash Cards - Send home or use for math c
Preview of Blending CVC Words Practice Short Vowels Word List Picture Cards Segmenting

Blending CVC Words Practice Short Vowels Word List Picture Cards Segmenting

Help students blend sounds to practice decoding CVC words with these CVC Blending Card Activities for Short Vowels! Teach students to blend over 200 CVC words to practice (preview includes a CVC word list)! These CVC Blending Cards are perfect for kindergarten and first-grade students using the Science of Reading strategiesWhat makes these blending cards unique? My blending cards are the only ones to include the swooping, dotted lines that indicate continuous and stop sounds! By blending and se
Preview of Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency Check out the BUNDLE for a discount on ALL Decoding Drills resources!Short Vowel Decoding Drills are here! After learning a new phonics skill, students need to apply that skill in word reading. ---------------------------------------------------------------------------------------------------------------------------- --DISTANCE LEARNING UPDATE - August 17, 2020--- ***I have now added DIGITAL versions of these Short Vowel Decoding Drills that have been formatted for us
Preview of Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Created by
Tammys Toolbox
These crazy phonics card games use the science of reading to help kids who need extra practice with nonsense word decoding strategies and syllable division rules. In Crazy Words, players must read single-syllable nonsense words to get rid of their cards. And in Crazy Nonsense Words 2 - Multisyllable Edition, players must use decoding skills to read multisyllable nonsense words correctly. Both games are great for providing practice with syllable division rules, syllable types, and decoding skills
Preview of Kindergarten High Frequency Sight Word Practice Sentences Worksheets

Kindergarten High Frequency Sight Word Practice Sentences Worksheets

Help your kindergarten students practice sight words in a fun way! This is a collection of worksheets that teach high frequency sight word sentences and decodable words. The sight words are introduced systematically, one per page, and most of the other words are short vowel words that can be easily decoded.There are 2 types of activities in this pack:1. The students will circle the sight word in each sentence, then read the sentence and color the matching picture to show comprehension. 2. The st
Preview of Decodable Fluency Passages and Phrases R-Controlled Vowels Distance Learning

Decodable Fluency Passages and Phrases R-Controlled Vowels Distance Learning

Created by
Hollie Griffith
Beginning readers need practice segmenting words, reading sight words, and developing reading fluency. This little bundle includes five fluency passages and comprehension questions to teach and reinforce those tricky r-controlled vowels. It also includes five sheets of fluency phrases. If you find these passages helpful, you might want to check out my other Fluency Passages and Sight Words Units...CVC & Pre-Primer (Unit 1)Blends & Primer (Unit 2)Digraphs/CVCe/CCVCe & Primer/1st Gr
Preview of Phoneme Grapheme Blending Letter Cards EDITABLE

Phoneme Grapheme Blending Letter Cards EDITABLE

OVERVIEWThese Orton-Gillingham inspired card packs are an excellent tool to support your students’ continued reading development!  The cards consist of 178 concepts, including short vowels, consonants, consonant blends, digraphs, vowel teams, r-controlled vowels, welded sounds, diphthongs, and other word endings, including -s, -es, -ed, and Magic E. These cards have been intentionally crafted to complement any scope and sequence you are currently using and are ideal for students in grades K-2 or
Preview of Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

This Orton Gillingham bundle includes an Orton Gillingham scope and sequence, an editable Orton Gillingham lesson plan & a printable phoneme card deck. This bundle is the MUST-HAVE for any Orton Gillingham tutor!The phonics card deck includes:every single phoneme taught in the Orton Gillingham scope and sequence5 common prefixesthe most common 28 suffixes!!! Card Deck Layout:The front of the card shows the grapheme (letter) and the back shows order of frequency, alternate spellings, and wo
Preview of Fry Sight Words Activities, Assessment, Progress Monitoring and Flash Cards

Fry Sight Words Activities, Assessment, Progress Monitoring and Flash Cards

Everything you need to help your students master Fry's first five hundred sight words!! This set includes a sight word assessment and activities for your students. There are student sight word lists, teacher data trackers, charts to plot accuracy and words per minute data, flashcards, a mini folder, and activities for students to practice their sight words. This set can be used for whole class, small group, or progress monitoring and intervention for individual students. It is important for
Preview of Letter Assessment and Data System

Letter Assessment and Data System

Letter Data SystemDo you need a way to keep data on your students for letters and letter sounds? This system has everything you need to keep data, engage your students, and get them excited about learning- while also involving parents!! This system is especially helpful for RTI students.This product has 5 components:1. Progress Monitoring Tools- this includes 2 letter/sound templates (with letters IN and OUT of order-see pics) and 1 editable template. Also included are the student sheets to lami
Preview of Alphabet Flashcards with Embedded Mnemonics - Science of Reading

Alphabet Flashcards with Embedded Mnemonics - Science of Reading

Research shows that kids learned letters and sounds faster using embedded mnemonics!These flashcards accompany my Embedded Mnemonic Posters and the research is included. A key card for images is also included!Want access to more resources like this aligned to the Science of Reading? Check out my membership and save time and money!A – apple/acornB – baseball (or bat and ball)C - caterpillar (or cocoon or chrysalis)D – doughnutsE – edge/emuF – flowerG – gameH – horseI – inch/ice creamJ – jewelryK
Preview of SCIENCE OF READING SOUND WALL WITH REAL MOUTH PICTURES CARD KINDERGARTEN 1ST 2ND

SCIENCE OF READING SOUND WALL WITH REAL MOUTH PICTURES CARD KINDERGARTEN 1ST 2ND

Created by
FREE YOUR HEART
SCIENCE OF READING SOUND WALL WITH REAL MOUTH PICTURES FOR ARTICULATION ⭐ CONSONANTS AND VOWEL VALLEY REFERENCE CARDS OR POSTERS WITH LOCKS FOR KINDERGARTEN AND 1ST / 2ND / 3RD GRADE Replace your word wall with this Science of Reading aligned student-friendly sound wall and facilitate your students' connection of phonemes to graphemes. This science of reading based sound wall will be the most beneficial tool for your students during phonics instruction and to guide them while reading and spelli
Preview of Phonogram Cards - Sound Spelling Cards - Phoneme Grapheme Spelling Cards

Phonogram Cards - Sound Spelling Cards - Phoneme Grapheme Spelling Cards

Phonogram cards are phonics cards that follow the science of reading. Where phonemes are sounds, phonograms are a letter or combination of letters that represent a sound. Phonogram cards are designed to teach students the combinations of letters that represent sounds. Use these sound spelling cards during whole group instruction, small groups, warm up, centers, or intervention.✨Want daily no prep phonemic awareness activities? Click hereBuy a sound wall with all 44 phoneme cards to explicitly te
Preview of Alphabet Videos and Movement Cards: Physical Phonics

Alphabet Videos and Movement Cards: Physical Phonics

Physical Phonics will help your students learn their alphabet and letter sounds by incorporating actions and movement. The alphabet sounds movement cards that are included use a multi-sensory approach to help students learn sounds through visual, auditory, and kinesthetic movement. By teaching children through many techniques, their brain is able to process the information in multiple ways. Physical Phonics helps meet the needs of all of your students, no matter which way they learn best. I have
Preview of Short Vowel CVC Flash Cards and Word Lists Bundle

Short Vowel CVC Flash Cards and Word Lists Bundle

Created by
Annie Jewell
This phonics resource is perfect for children who are beginning to blend and those that need extra practice with blending fluency. This set focuses on short vowel words. Most words are either vc or cvc.243 word cards (flashcards) are included in color and blackline. There are 6 cards per page. Additionally, these can be used when working on Word Families- lots of possibilities with this set.This resource includes 50 Word Lists. Each list is generally grouped by word families, changing the final
Showing 1-24 of 3,768 results

Find Phonics resources | TPT

Learn more about phonics resources

You’ve probably heard that phonics is essential for students who are learning to read (and it is!), but you might be asking yourself: “What is it, exactly?” Phonics is a method for teaching children how to read and write in an alphabetic language. The goal is to help kids connect phonemes (the sounds in words) and graphemes (the symbols used to represent them). Ultimately, once students understand which sounds in spoken language correspond to which symbols (e.g., letters in the alphabet), they’ll be well on their way to learning how to read books and other written materials.

If you’re a teacher or parent looking for printable and digital resources to help your student learn phonics, but you’re not sure where to start, TPT has got you covered. We have a comprehensive collection of phonics resources, created by other teachers, that are designed to help with any learning need. With plenty of TPT resources at your fingertips, you can teach phonics to your students in no time at all.

Phonics resources to try

You can teach phonics and engage your students at the same time, with a variety of activities that cater to different learning styles and preferences. Here are a few examples of the different types of resources that you can find on TPT to help teach students about the relationships between letters and sounds.

Alphabet Scavenger Hunt

Hide letter cards around the room, say a sound aloud, and then have students search for the card that represents the sound.

Phonics Hopscotch

Take learning out onto the playground or at home with this easy-to-organize activity to help students build sound and letter recognition. Draw a hopscotch grid with letters in each square. Students jump on the letters while saying the corresponding sounds.

Silly Sentences

Have students create silly sentences using words that start with the same sound. An example could be: “Sally sells seashells by the shore.”

Anchor Charts

Post anchor charts around the room to help kids remember important rules or sounds being taught. (It could cover phonics concepts like the silent “e,” the long “o,” or a particular diphthong.)

Guess the Missing Letter or Sound

Use task cards or write a set of words on the board that share either a letter or sound. For example, at, ug, __ig. Ask students to find the missing letter or sound. Fill it in to show them the words bat, bug, and big.

These (and other!) activities can make learning phonics enjoyable and memorable for every student. Remember to adjust the activities based on the age and skill level of your students.

Frequently asked questions about teaching phonics

What types of phonics resources are available on TPT?

There are many different types of phonics resources sold by Sellers on TPT — from worksheets to interactive notebooks to units. Resources like these make great activities for students to practice their phonics skills.

How do I find phonics resources on TPT?

Educators can save time preparing phonics lessons with resources created by experienced teachers. Simply start a search for phonics resources on the TPT marketplace, and filter by grade level, price, and/or resource type to find materials that've been proven to work in classrooms like yours. No matter what you’re teaching, there are plenty of phonics lessons and activities sold by Sellers on TPT that are tailored to meet your students' skill levels.